PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G077900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 390aa    MW: 43049.1 Da    PI: 9.7893
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G077900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-17128171146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg++++eE++l+++++++lG++ W++Ia++++ gRt++++k++w++
  Seita.1G077900.1.p 128 RGAMSPEEELLFLRLHALLGNK-WARIAAHLP-GRTDNEIKNYWNT 171
                         899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.65481122IPR017930Myb domain
SuperFamilySSF466891.05E-2183169IPR009057Homeodomain-like
SMARTSM007170.03285124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-1187129IPR009057Homeodomain-like
CDDcd001677.53E-888171No hitNo description
PROSITE profilePS5129426.418123177IPR017930Myb domain
SMARTSM007175.8E-17127175IPR001005SANT/Myb domain
PfamPF002492.1E-16128171IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-23130176IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MRKFQRRDHL PLPPSSPRAY SRKRRKRRRE AGDGCTPEVP RRHLRRRSSD GDICLVAVGM  60
ARDEGSTKRS VEKKQAPGEE DASLKKGSWT AEEDEKLVGH VRRKTGLRRC GKSCRLRWTN  120
HLRPDLKRGA MSPEEELLFL RLHALLGNKW ARIAAHLPGR TDNEIKNYWN TRMKRRERAG  180
LPLYPPEVEH EVALIRAGGP NTILDAGADD RVKPQEQPPF LFDAADPLTL LSLPPPASDS  240
PAAIYHFSMA AREPRPLPSI DDLKIDPSNY LPLAPLLPPM AHRELPSIQS AAIATGATLE  300
TAFLCDPEHQ QVAAASLVNF GTMPGLVSHE NIDSSGPSGG RSSRSEGGDT PLHCTQEEGL  360
LNLGGKRGCL SGELSMAFSL NPLFILVKW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-248117622127MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12129RKRRKRRRE
22228KRRKRRR
32428RKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954707.10.0PREDICTED: transcription factor MYB104-like
TrEMBLA0A0A9KTW63e-79A0A0A9KTW6_ARUDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2537733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.22e-41myb domain protein 101